PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012454-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 259aa    MW: 30122.2 Da    PI: 9.2508
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012454-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.4e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v+++G g+W+++ar  g++R +k+c++rw +yl
    NNU_012454-RA 16 KGPWTAEEDKLLTEYVRLHGEGRWNSVARLAGLRRNGKSCRLRWVNYL 63
                     79********************************************97 PP

2Myb_DNA-binding51.52.3e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg  T+ E+ ++ ++++++G++ W+tIar ++ gRt++++k++w+++l
    NNU_012454-RA  69 RGQITPHEESIIMELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTHL 114
                      7888******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3511163IPR017930Myb domain
SuperFamilySSF466893.67E-3013110IPR009057Homeodomain-like
SMARTSM007174.1E-161565IPR001005SANT/Myb domain
PfamPF002492.3E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-231770IPR009057Homeodomain-like
CDDcd001672.35E-111863No hitNo description
PROSITE profilePS5129424.48264118IPR017930Myb domain
SMARTSM007174.7E-1468116IPR001005SANT/Myb domain
PfamPF002491.1E-1369114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2471117IPR009057Homeodomain-like
CDDcd001671.60E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MAGKLGWGIL EEGWRKGPWT AEEDKLLTEY VRLHGEGRWN SVARLAGLRR NGKSCRLRWV  60
NYLRPDLKRG QITPHEESII MELHARWGNR WSTIARSLPG RTDNEIKNYW RTHLKKKSEA  120
SPEHSERSKA RLLRQQMQQK RQQFQLQQQQ QQQQLQKKNQ QNQVGMKKIM SLLDECDHRL  180
LPLVQEREDM VFMYPSTSEE QCLLSPVFNS DTSVPEASSS EEILWGGLWN LDDVQSNLDS  240
TCATSKACLP NMITPLPSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-261611727127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264825.10.0PREDICTED: transcription factor MYB59-like
TrEMBLA0A061EPG81e-116A0A061EPG8_THECC; Myb domain protein 79 isoform 1
STRINGPOPTR_0008s17350.11e-107(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.13e-77myb domain protein 305